LL-37, LL37, CAMP Cellmano Biotech Limited

To: Cellmano Biotech Limited <qilin@cellmano.com>
Subject
Quantity

Deliver to

My Contact
Your Message (Optional)

Product Name	LL-37
Synonyms	CAMP LL37 LL-37 hCAP18 Protein Antibacterial LL-37, LL37, CAMP Synonyms CAMP LL37 LL-37 hCAP18 Protein Antibacterial LL-37, LL37, CAMP LL-37 human acetate Cathelicidin LL 37 (human) LL-37 (trifluoroacetate salt) Antibacterial Protein LL-37 (human) [LL-37, 37 aa] Antibacterial Protein LL-37 (huMan), LL37, CAMP H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS	154947-66-7
EINECS	211-519-9
Chemical Formula	C205H340N60O53
Molecular Weight	4493.33
inchi
Package	1g
Price	Email to quote
Descriptions
Last Update	2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 204656-20-2
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 137525-51-0
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 62568-57-4
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 307297-39-8
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 1627580-64-6
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 80714-61-0
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 1401708-83-5
Last Update: 2023-04-27 18:30:20

Category: Chemical Reagents
CAS: 129954-34-3
Last Update: 2023-04-27 18:30:20