Name | sermorelin |
Synonyms | SERMORELIN sermorelin SERMORELIN ACETATE GRF (1-29) amide (human) YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 growth hormone releasing factor*fragment 1-29 ami GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN |
CAS | 86168-78-7 |
EINECS | 1312995-182-4 |
InChI | InChI=1/C149H246N44O42S/c1-20-77(13)116(191-122(211)81(17)168-132(221)104(66-113(204)205)178-121(210)79(15)167-123(212)88(152)62-84-39-43-86(198)44-40-84)145(234)185-102(63-83-32-23-22-24-33-83)138(227)193-118(82(18)197)146(235)186-103(65-111(155)202)137(226)189-108(71-196)142(231)182-101(64-85-41-45-87(199)46-42-85)136(225)175-93(38-31-56-165-149(161)162)126(215)174-91(35-26-28-53-151)131(220)190-115(76(11)12)143(232)184-97(58-72(3)4)124(213)166-68-112(203)170-94(47-49-109(153)200)128(217)180-100(61-75(9)10)135(224)188-106(69-194)140(229)169-80(16)120(209)172-92(37-30-55-164-148(159)160)125(214)173-90(34-25-27-52-150)127(216)179-99(60-74(7)8)134(223)181-98(59-73(5)6)133(222)176-95(48-50-110(154)201)129(218)183-105(67-114(206)207)139(228)192-117(78(14)21-2)144(233)177-96(51-57-236-19)130(219)187-107(70-195)141(230)171-89(119(156)208)36-29-54-163-147(157)158/h22-24,32-33,39-46,72-82,88-108,115-118,194-199H,20-21,25-31,34-38,47-71,150-152H2,1-19H3,(H2,153,200)(H2,154,201)(H2,155,202)(H2,156,208)(H,166,213)(H,167,212)(H,168,221)(H,169,229)(H,170,203)(H,171,230)(H,172,209)(H,173,214)(H,174,215)(H,175,225)(H,176,222)(H,177,233)(H,178,210)(H,179,216)(H,180,217)(H,181,223)(H,182,231)(H,183,218)(H,184,232)(H,185,234)(H,186,235)(H,187,219)(H,188,224)(H,189,226)(H,190,220)(H,191,211)(H,192,228)(H,193,227)(H,204,205)(H,206,207)(H4,157,158,163)(H4,159,160,164)(H4,161,162,165) |
InChIKey | BVLCEKWPOSAKSZ-YQMCHIOTSA-N |
Molecular Formula | C149H246N44O42S |
Molar Mass | 3357.93 |
Density | 1.45±0.1 g/cm3(Predicted) |
Melting Point | >189°C (dec.) |
Specific Rotation(α) | D20 -63.1° (c = 1 in 30% acetic acid) |
Solubility | Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly) |
Appearance | Solid |
Color | White to Off-White |
Storage Condition | −20°C |
Stability | Hygroscopic |
Refractive Index | 1.649 |
WGK Germany | 3 |
Overview | Semorelin (Sermorelin) is a synthetic growth hormone releasing hormone with 29 amino acid polypeptide, which is an amino terminal fragment of endogenous growth hormone releasing hormone (GHRH) and has a significant growth regulating effect. It is proposed that neuropeptides/neurotransmitters, hormones and cytokines are the "common language" of mutual regulation among the three major systems of nervous system, endocrine system and immune system ". In addition to its very fine regulatory mechanism, the immune system is also regulated by the neuro-endocrine-immune network. |
Pharmacology | Semorelin is a synthetic polypeptide different from growth hormone releasing hormone (GHRH), which promotes the release of growth hormone by the pituitary gland. The experimental results show that sermorilin can antagonize the immunosuppressive effect of immunosuppressant cyclophosphamide in mice. In the body's immune system, macrophages play an important role in specific and non-specific cellular immune function and immune regulation. Semorilin can significantly increase the weight of thymus and spleen of immune organs in immunocompromised mice, and improve the phagocytic function of mononuclear phagocytes, suggesting that it can enhance the non-specific immune function of mice. Cyclophosphamide can inhibit the proliferation of T lymphocytes, and Semorilin can obviously resist the toxic effect of CY on lymphocytes, so that the proliferation of T lymphocytes can be restored. dinitrochlorobenzene (DNCB) is a hapten. Once it penetrates into the skin, it binds to the skin protein to form a complete antigen, which stimulates T lymphocytes to proliferate into sensitized lymphocytes. Re-contact with DNCB will produce delayed-type hypersensitivity. The immune function of the body can be judged by the degree of ear swelling. Semorilin can increase the degree of ear swelling in immunosuppressed mice. At the same time, it also increases the content of IL-2. IL-2 is mainly produced by T lymphocytes, it can also indirectly reflect the function of cellular immunity. The above results suggest that semorilin can improve the cellular immune function of immunosuppressed mice, indicating that it has a certain immune regulation effect, and can restore the suppressed immune function to close to normal levels, especially the effect of high dose is more obvious, but there is no significant difference between high and low doses, indicating that there is no dose dependence. The mechanism may be by promoting the release of growth hormone (GH). GH is a kind of anterior pituitary hormone, which has a wide range of effects on the immune system. Almost all immune cells have the effect of promoting differentiation and enhancing function. The regulation of GH on the immune system may be realized by regulating the growth of lymphoid tissue, therefore, the enhancement effect of semorelin on the immune system may also be carried out through GH; another possibility is that semorelin itself has the effect of enhancing immune function, and the specific mechanism needs further study. |
Preparation | Step 1: The synthesis of the solid-phase peptide is carried out on the order of 100 μmol. The following protected amino acids are added to the resin: fmoc-Arg (Pbf)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Met-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ala-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Phe-OH, Fmoc-IIe-OH, Fmoc-Ala-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ala-OH, Boc-Tyr(tBu)-OH. They dissolve into N,N-dimethylformamide (DMF) and, in order, utilize O-benzotriazole-1-yl-N,N,N′,N′-tetramethylurea hexafluorophosphate (HBTU) and diisopropylethylamine (DIEA) activation. The removal of the Fmoc protecting group was accomplished using a solution of N,N-dimethylformamide (DMF) of 20%(V/V) piperidine for 20 minutes (step 1). The amino group of the final amino acid is acetylated with acetic acid activated by O-benzotriazol-1-yl-N,N,N′,N′-tetramethylurea hexafluorophosphate (HBTU) and diisopropylethylamine (DIEA). Step 2: Cut the peptide from the resin using 85% TFA/5% TIS/5% phenylthio methane and 5% phenol, and then settle with dry ice-cold (0-4°C) Et2O. The crude peptide is collected in a sintered polypropylene funnel, dried, and redissolved in a mixture of water (0.1% TFA) 40% acetonitrile, and then freeze-dried to produce the corresponding crude extract, which is used in the purification process. |
References | [1] Zhang Lifeng, Ma Xingming, Liu Yanling, Yin Shaofu. Experimental Study on Antagonistic Effect of Semorelin Acetate on Cyclophosphamide Immunosuppression [J]. Journal of Cellular and Molecular Immunology, 2005(01):98-99. [2] Zhang Li Feng, Liu Yanling, Yin Shaofu. Immunological activity of semorelin acetate [J]. China Public Health, 2004(11):60-61. |
use | treat dwarfism and promote children's growth |