223460-79-5
GLP-2 (HUMAN)
CAS: 223460-79-5
Molecular Formula: C165H254N44O55S
223460-79-5 - Names and Identifiers
223460-79-5 - Physico-chemical Properties
| Molecular Formula | C165H254N44O55S |
| Molar Mass | 3766.10906 |
| Appearance | solid |
| Storage Condition | −20°C |
223460-79-5 - Risk and Safety
| Safety Description | S22 - Do not breathe dust. S24/25 - Avoid contact with skin and eyes. |
| WGK Germany | 3 |
223460-79-5 - Preparation solution concentration reference
| 1mg | 5mg | 10mg | |
|---|---|---|---|
| 1 mM | 0.266 ml | 1.328 ml | 2.655 ml |
| 5 mM | 0.053 ml | 0.266 ml | 0.531 ml |
| 10 mM | 0.027 ml | 0.133 ml | 0.266 ml |
| 5 mM | 0.005 ml | 0.027 ml | 0.053 ml |
Last Update：2024-01-02 23:10:35
Supplier List
Spot supply
Product Name: GLP-2(1-33)(human) Request for quotationCAS: 223460-79-5
Tel: 400-968-2212
Email: 3623107365@qq.com
Mobile: 18916960931
QQ: 3623107365
Wechat: 18916960931
Spot supply
Product Name: GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: +86-18821248368
Email: Int06@meryer.com
Mobile: +86-18821248368
QQ: 495145328
WhatsApp: +86-18821248368
Spot supply
Product Name: GLP-2(1-33)(human) Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: +86-400-900-4166
Email: product@acmec-e.com
Mobile: +86-18621343501
QQ: 2881950922
Wechat: 18621343501
WhatsApp: +86-18621343501
Spot supply
Product Name: GLP-2(1-33)(human) Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: 609-228-6898
Email: sales@medchemexpress.com
tech@medchemexpress.com
Mobile: 609-228-6898
Spot supply
Product Name: GLP-2 (HUMAN) Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: 18301782025
Email: 3008007409@qq.com
Mobile: 18021002903
QQ: 3008007409
Spot supply
Product Name: GLP-2(1-33)(human) Request for quotationCAS: 223460-79-5
Tel: 400-968-2212
Email: 3623107365@qq.com
Mobile: 18916960931
QQ: 3623107365
Wechat: 18916960931
Spot supply
Product Name: GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: +86-18821248368
Email: Int06@meryer.com
Mobile: +86-18821248368
QQ: 495145328
WhatsApp: +86-18821248368
Spot supply
Product Name: GLP-2(1-33)(human) Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: +86-400-900-4166
Email: product@acmec-e.com
Mobile: +86-18621343501
QQ: 2881950922
Wechat: 18621343501
WhatsApp: +86-18621343501
Spot supply
Product Name: GLP-2(1-33)(human) Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: 609-228-6898
Email: sales@medchemexpress.com
tech@medchemexpress.com
Mobile: 609-228-6898
Spot supply
Product Name: GLP-2 (HUMAN) Visit Supplier Webpage Request for quotationCAS: 223460-79-5
Tel: 18301782025
Email: 3008007409@qq.com
Mobile: 18021002903
QQ: 3008007409
View History